SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002830 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002830
Domain Number 1 Region: 404-662
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-76
Family Eukaryotic proteases 0.000000481
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-32
Family Spermadhesin, CUB domain 0.00000259
Further Details:      
 
Domain Number 3 Region: 344-415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.0000404
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000002830
Domain Number - Region: 277-314
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00115
Family Complement control module/SCR domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002830   Gene: ENSMEUG00000003102   Transcript: ENSMEUT00000003109
Sequence length 666
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_171:3839:16827:-1 gene:ENSMEUG00000003102 transcript:ENSMEUT00000003109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEAIFGRLTSPGFPEVYPNNEEQSWNLTVPPGYRIRLYFTHFNLELSYLCEYDFVKLYSG
DKLLAVLCGQESTDTEQAPGNHTFHSVGSNLRVAFRSDYSNEKDFTGFEAFYAAEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPCPDPILPPHGRIAPVQPKYILKE
HFSLSCETGYVLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXVDCGPPDDLLNGQVTYITE
GEVTTYEAVIQYSCKDPFYTMKMNNDGKYRCGADGFWKSSKGENSLPVCEPVCGVASQRM
ERILGGSKAKLGEFPWQVMLLGEVLAGGALLYDNWVLTAAHVIHEQKDLSSLEIRMGFLK
RLSPHYTTAWADKVFIHEGYTYDEANFDNDIALIKLKNHVEINRNVTPICLPRKNGTQVK
ARDLGVVSGWGRTKKAFRAHSLMYVELPVVDQQTCLAAFENSKSPGGKPLVLTDNMICAG
FQSGGNDSCSGDSGGPLVFLDHETKKWFVGGIVSWGLGCGKANQYGVYTNVMNYIPWIEN
IILNNS
Download sequence
Identical sequences ENSMEUP00000002830 ENSMEUP00000002830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]