SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002837 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002837
Domain Number 1 Region: 301-516
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-53
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 819-1116
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000161
Family WD40-repeat 0.017
Further Details:      
 
Domain Number 3 Region: 529-612,706-750
Classification Level Classification E-value
Superfamily PH domain-like 0.0000109
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002837   Gene: ENSMEUG00000003098   Transcript: ENSMEUT00000003117
Sequence length 1267
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_922:9773:144250:1 gene:ENSMEUG00000003098 transcript:ENSMEUT00000003117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSDPSPQPAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXILAVVSNGEPVGAGIRRSSWKRKSSRRVDRFTFP
ILEEDVIYDDVPCENLDSQKHGSERSLIYENVHREGGPRDSEDLGWSSSEFESYSEESGE
EEVKPEVEPTKHRVSFQPKLSPDLSRLKERYARTKRDILALRVGGRDMQDLKQKYDCKMT
QLMKAAKSGTKDGLEKTRMAVMRKVSFLHRKEVLGDSEEEDMGFLEVTVSDIKHPAPELG
PMPDGLSPQQVVRRHILRSIVQSEGSYVESLKRILQDYRNPLMEMEPKVLSARKCQVVFF
RLKEILQCHSMFQIALSSRVAEWDATEKIGDLFVASFSKSMVLDVYSDYVNNFTTAMSII
KKACLTKPAFLEFLKRRQVSSSDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPKGHPDRL
SLQLALTELETLAEKLNEQKRLADQLAEIQQLTKSVSDRSSLNKLLTSGQRQLLLCETLT
ETVYGDRGQLIKSKERKVFLLNDMLVCANINFKPVNHRGQLEISSLVPLGPKYVVKWNTA
LPQVQVAEVGQEGGTYDKDNVVIQNAGAKKSSPASQAHNKVYLGPPRLFQELQDLQKDLA
VVEQITLLISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSANKCRLRLLLPGKPDK
SGRPISFMVVFITPNPLSKISWVNRLHLAKIGLXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLRSLIHSPVHSPLLGFSAVSTSLPQGYLWVAGGQDGAGGQVEIFSL
NRPTPRMVKSFPVASPVLCMEYIPEKNEEDEDQKSGRAVPDSSSVIHPTICLGLQDGSIL
VYGSVDTGTQCLVTCKSPGLQPVLCLCYSPHYLFAGLQDGTVAAYLQSSGGLWDMESPPT
CLTVGPGPVRTVLSLEDAVWASCGHQVTVLDPATLQTQQSFEAHQDEAASVTHMVKAGSG
VWMAFSLGSSIRLFHTETLEHLQEINIATRTTFLMPGQKHVCVTSLLICQGQLWVGTDQG
IIVLLPVPRLEGIPKITGKGMVSLNGHCGPVDFLAVATSTLAPDILRSDQDEAEEEKGEG
PSHEPPPAPDSHPPRELVHKKGILLQYRLRSTAHLPGPILSVRDPPDPDGTALAHSEEDG
SIYEMADDPDVWVRSRPCARDAHRKEISSVAIISGGQGYRNFGGGGRPALGSETDSTLLI
WQVPLMI
Download sequence
Identical sequences ENSMEUP00000002837 ENSMEUP00000002837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]