SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003782 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003782
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-29
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 148-212
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.63e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003782   Gene: ENSMEUG00000004164   Transcript: ENSMEUT00000004160
Sequence length 249
Comment pep:known_by_projection scaffold:Meug_1.0:Scaffold55406:5012:5761:1 gene:ENSMEUG00000004164 transcript:ENSMEUT00000004160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFND
ILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKS
EWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGF
VVCGPCSEKRFLLPSQSSKPVRICDFCFDLLSSGDLATCQPSRSDSYSQSPKSPLNNVSD
DEDDEDSSD
Download sequence
Identical sequences ENSMEUP00000003782 ENSMEUP00000003782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]