SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003881 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003881
Domain Number 1 Region: 3-199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.52e-66
Family Motor proteins 0.00000000478
Further Details:      
 
Domain Number 2 Region: 1539-1636
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-23
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 455-544
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.97e-21
Family FHA domain 0.0000287
Further Details:      
 
Domain Number 4 Region: 285-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000414
Family Motor proteins 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003881   Gene: ENSMEUG00000004219   Transcript: ENSMEUT00000004272
Sequence length 1643
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8525:2591:115683:-1 gene:ENSMEUG00000004219 transcript:ENSMEUT00000004272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVNPKQPKETPKSFSFDYSYWSHTTPEDINYASQKQVYQDIGEEMLQHAFEGYNVCIFAY
GQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRD
LLNPKNKGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSR
SHAVFNIIFTQKRHDAETNITTEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNSRTAMVAALSPADI
NYDETLSTLRYADRAKQIRCNAVINEDPNNKLIRELKDEVARLRDLLYAQGLGDIIDMTN
ALVGMSPSSSLSALSSRAASVSSLHERMLFAPGSEEAIERLKETEKIIAELNETWEEKLR
RTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGIT
RVGREDGERRQDIVLSGHFIKEEHCIFRSDTRAGNEAVVTLEPCEGADTYVNGKKVTEPS
ILRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLQELEDQYRKEREEANYLLEQQRLDYESKLEALQKQMDSRYYPEVNEEEEEPEDE
VQWTEREFELALWAFRKWKWYQFTSLRDLLWGNAIFLKEANAISVELKKKVQFQFVLLTD
TLYSPLPPDLLPPDAAKEREKRPFPRTIVAIEVQDQKNGATHYWTLEKLRQRLDLMREMY
DRAAEVPSSVIEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEK
GEVKGFLRVAVQAISADEEAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGT
SQEELRIVEGQGQVTEIGPSADEVNNNTCAAVTPEDLLLDSPEKSIMDGPLESALDHLKL
GSIFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIA
VEVTKSFVEYIKSQPIVFEVFGHYQQHPFPPLCKDVLXXXXXXXXXXXXXXXXXXXXPAT
KLSTLTRPTAGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCLGTFLLHQGIQRR
ITVTLVHETGSHIRWKEVRELVVGRIRNTPETDESLIDPNILSLNILSSGYVQPSQDDRT
FYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVITKDFCMVFYSRDA
KLPASRSIRNLFGSGSLRASESNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVR
GEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETTQRSGLETLSPCS
SEDSESHSTSCVSSPLSDGTSESRATTLDIPSERQKELAAKCLRLLTHTFNREYTHSHVC
VSASESKLSEMSVTLLRDPSMSPLSAATLTPSSTCPSLVEGRYTAXXXXNPPPCSRPVSP
ELEPVLEGEQKKSPSPASGPEAEKEPQRLLVPDIQEIRVSPIVSKKGYLHFLEPKTTGWA
KRFVVVRRPYAYMYNSDKDAVERFILNLSTAQVEYSEDQQAMLKTPNTFAVCTEHRGILL
QANSDKDMHDWLYAFNPLLAGTI
Download sequence
Identical sequences ENSMEUP00000003881 ENSMEUP00000003881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]