SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003983 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003983
Domain Number 1 Region: 41-258
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.47e-38
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 410-525
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-28
Family DEP domain 0.003
Further Details:      
 
Domain Number 3 Region: 556-638
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000441
Family DEP domain 0.011
Further Details:      
 
Domain Number 4 Region: 347-393
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000132
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 5 Region: 618-706
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000024
Family PDZ domain 0.031
Further Details:      
 
Domain Number 6 Region: 710-773
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000266
Family PDZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003983   Gene: ENSMEUG00000004319   Transcript: ENSMEUT00000004382
Sequence length 1667
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3594:35220:209585:-1 gene:ENSMEUG00000004319 transcript:ENSMEUT00000004382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSGGSSPGAAGPRPRGRPRPWPGPAVVSAGPGRCAAARDSERQLRLRLCVLNEILGT
ERDYVGTLRFLQSAFLHRIRQNVADSADKCITEENVKILFSNIEDILEVHKEFLNALEFC
LQPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLMELNKIPAIRAFLLXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXELAKRTPGKHPDHPAVQSALQAMKTVCTNINET
KRQMEKLEALEQLQSHIEGWEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYHSNGYTVTNGWK
IHNTAKNKWFVCMAKTAEDKQKWLDAIIKEREQRESLKLGMERDAYVMIAEKGEKLYHMM
MSKKVNLIKDRRRKLSTVPKCFLGNEFVSWLIEIGEISKTEEGVNLGQALLENGIIHHVS
DKHQFKNEQVMYRFRYDDGTYKPRSELEDIMSKGVRLYCRLHSLFTPVIXXXXXXXXXXX
XXXXXXXXXXXXXXXGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHADEE
MEGTSSKNKLLRNDFKLVENILARSLLILPQEDDYGFDIEEKSKVIMVKSVQRGSLAEMA
GLQVGRKIYSINEDLVFLRPFSEVEAILNQSFCSRRPLRLVVASKAKEIIKVPDHPETLC
FQIRGDSPPYVHAVGRGSEAAAVGLNAGQCILKVNGNNVMNDSFAEVLDHFLAYRSRQQE
ALGVYQWIYRTHEDVEEARAKQWGPDSYLNGSLDEARGHGVLDGGQDDEDFSLQSMGPQL
TIPEGSPLISLTVENVHLEHGVVYEYVSTAGIKCFVVEKIVEPKGCFALAAKILEAFAAD
DSLFVQNCGRLISLSSAMVTMSQYEFRNICETKLERITRRIANYQEFAEQLKTRVSPAFK
QASLEPHALCSLDFCPTNCHVNLMEVSYPKNTTSVGRSFSIRFGRKPSLIGLDPEQGHIN
PMSYTQHCITTMAAPSWKCFSEDGESHDRSLLDSTLPANGGPGQEDRGLSFLLKQEDREI
QDAYLQLFNKLDVAVKEMKQYVMQINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXECNSNRDSVLSYTSVRSNSSYLGS
DEMGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDSINALLKGSVMSKAFEETKHFPMEH
SLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXREERIMLEDIRVTLSELDNVTFLFKQLDENFVTNTHVFYHIEGSRQ
ALKVIFYLDSYHFSKLPTRLENGGSLRLHTVFFTKALDNLEGQPQAGGSTTALLEELQQE
INAQSLEKVQQYYRRLRTFYLERSNLPTDASATAVKIDQLIRPINAMDELCRLMKSFVHS
KPGXXXXXXXXXXXXXXXXXXXXXXCQVTMCGTGMQRSTLSVSLEQAAILARSHGLLPKC
IMQATDIMRKQGPRVEILAKNLRIKDQMPQGAPRIYQLCQPPVDGDL
Download sequence
Identical sequences ENSMEUP00000003983 ENSMEUP00000003983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]