SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004185 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004185
Domain Number 1 Region: 13-208
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-42
Family Nuclear receptor ligand-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004185   Gene: ENSMEUG00000004593   Transcript: ENSMEUT00000004603
Sequence length 208
Comment pep:known_by_projection scaffold:Meug_1.0:Scaffold109201:4687:6848:1 gene:ENSMEUG00000004593 transcript:ENSMEUT00000004603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASSGACECQGRDSQHAILYSLLSGPRPSPHAHCLCARHRTVCLRAPQHTCLAAAGVLA
KTITFLQNLPSFGLLPPGDQRLLLANCWAPLFLLGLAQDAVTIEVTEMPAPSMLKKILLE
ERSPEPQRPQPTLAGVHRLQCCLHTFWSLDLSPKEYAYLKGAILFNPDTPGLQTASYVES
LHREAEQVLQEALALHHPVDQGCFARIL
Download sequence
Identical sequences ENSMEUP00000004185 ENSMEUP00000004185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]