SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004326 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004326
Domain Number 1 Region: 133-460
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.31e-55
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000228
Further Details:      
 
Domain Number 2 Region: 464-600
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.24e-18
Family Ricin B-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004326   Gene: ENSMEUG00000004733   Transcript: ENSMEUT00000004750
Sequence length 607
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2496:31598:241199:-1 gene:ENSMEUG00000004733 transcript:ENSMEUT00000004750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRVQEPVPDKKLEEDKGDTL
RIIERLDHLENVIKQHIQEAPAKPEESAAEAFTDSSLFAHWGQDLSPESRRIALKQFQYY
GYNAYLSDRLPLDRPLPDLRPNGCRNLSFPDSLPEVSIVFIFVNEALSVILRSIHSAIDR
TPPHLLKEIILVDDNSSNEELKEKLKDYVDKVNAHKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEEYPLAAQGF
DWELWCRYLNPPKSWWKLENSTAPIKSPALIGCFIVDRQYFQEIGLLDEGMEVYGGENVE
LGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA
WNIPLEDPGIDIGDISTRKALRKKLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKSD
LCLDQGPDTENVPIMYLCHGMTPQNVYYTSSQQLQLGVLSPTVDDDDNRCLVDVNSRPRL
IECSYAKAKRMKLHWHFSQESPIQNQRSKRCLELQENSDNEFGFKLVLQKCSGQHWSITN
ILQSLSS
Download sequence
Identical sequences ENSMEUP00000004326 ENSMEUP00000004326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]