SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004347 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004347
Domain Number 1 Region: 209-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000612
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 61-122
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000375
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 24-76
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004347   Gene: ENSMEUG00000004761   Transcript: ENSMEUT00000004774
Sequence length 412
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1806:4262:39446:-1 gene:ENSMEUG00000004761 transcript:ENSMEUT00000004774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPWCSPIKVKYGDVYCRAPHGGYYKNVLGTRCEVRCRKGYELHGSSQLTCQPNKRWSDKV
LCKQKRCPILSMPANGGFKCIDGAYFNSRCEYYCTPGYTLKGERTVVCMDNKSWSGRPAM
CVXXXXXXEIQCPSVKERIAEPNKLTVRVFWETPEGRDTADGILTDVILKGLPPGSDFPE
GHHKIQYTVYDRAENKGTCKFHVKVRVQRCNKLHAPENGYIKCSSDGNNYGATCEFSCIG
GYELQGSPARVCQSNLAWSGTDPTCKAMKISVGVRTAAALLDQFYEKRRLLIVSTPTARN
LLYRAQLSMLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLLRIPLN
TFSILLVDKHGMDKERYMSIVTPVTLFNLIDTFPLRKEEMVIQAEMGQACNT
Download sequence
Identical sequences ENSMEUP00000004347 ENSMEUP00000004347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]