SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004671 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004671
Domain Number 1 Region: 251-469
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-50
Family DBL homology domain (DH-domain) 0.0000937
Further Details:      
 
Domain Number 2 Region: 459-599
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-17
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Domain Number 3 Region: 612-672
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000125
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004671   Gene: ENSMEUG00000005103   Transcript: ENSMEUT00000005122
Sequence length 692
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4044:6169:39773:1 gene:ENSMEUG00000005103 transcript:ENSMEUT00000005122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRHSDGSLDEKSKLLEYRFHSELCLDKDGNPVSGLPASRSSLRSFQEEHPPGEPHSII
LSTESPAALKMGTQQLIPKSLAVSTKAKTPTRHQSFAVSMLSKDLSQQNLKRMSVPSFSR
DDLDMDVTSEGTLKRNLRNQSYRAAMKGPSPAEAKRVNTLKPLAEESTQGRARSPGRSKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXVVESGILDQLSPEERKRQEAIFEIITSEFSYLHSLKILVSEFLRSKELR
ETMTQMEHHHLFSNIVDVQGASQKFFEDLEKRHKEHVCVTDISDILEEHALQHFHPYVVY
CSNEVYQQRTLQKLMNSSSAFRDVLKEIERKPACGGLPMISFLILPMQRVTRLPLLMDXX
XXXXXXXXXXXXXXXXXXXXXXXLVKQCNEGAHKMERTEQMYNLQTQLDFSKIKAFPLIS
ASRWLLKRGELFLVEEPSLFRKISSRPTCYLFLFNDALMVTKKKSEEHYVVMDYAKMDHI
QVKKVEPDEISLPGGSNRSSSIPYPFQVTMLKNSEGKQEQILLSSDSSSDRARWITALEH
KENQEQGLASKGELHQVEITKAYFAKQADEITLQQADVVLIQKQEDGWFYGERLRDGEIG
WFPEDYARAITSRVAVEGNVRRLERLRVETDV
Download sequence
Identical sequences ENSMEUP00000004671 ENSMEUP00000004671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]