SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000004797 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000004797
Domain Number 1 Region: 128-505
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.39e-78
Family L-arabinose binding protein-like 0.00076
Further Details:      
 
Domain Number 2 Region: 55-116
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000361
Family Complement control module/SCR domain 0.00011
Further Details:      
 
Domain Number 3 Region: 13-60
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000931
Family Complement control module/SCR domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000004797   Gene: ENSMEUG00000005244   Transcript: ENSMEUT00000005259
Sequence length 925
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9863:527:22981:-1 gene:ENSMEUG00000005244 transcript:ENSMEUT00000005259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRGLTRDQVRAINFLPVDYEIEYVCRGDREVVGPKVRKCLSNGSWTDMDMPSRCVRTCSK
SYLTLDNGTAFLRGGNRPALDGAWVDFRCDPGFHLVGSSRSICARGQWDTPKPSCQVKRT
TYTGRRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDP
GQATKYLYELLYNDPIKIILLPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPT
FFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQS
FFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFR
TPDPAINCTEQEMAEAVEGHVTTEIVMLNPENTRGISNMTSQEFVQKLTQRLGSKKAEET
GGFQEAPLAYDAIWALALALNKTSGGSGVHSSGGVRLEDFNYNNQTITDQIYRAMNSSSF
EGVSGHVVFDASGSRMARTLIEQLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPADQT
VVITTFRYLSQKLFISVSVLSSLGIVLAIVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCS
LALAAVFPLGLDGYHIRQGHFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEK
KERRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLC
LITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKT
GSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPDPSG
GLPCGTSEPPDRLSCDGSRVHLLYK
Download sequence
Identical sequences ENSMEUP00000004797 ENSMEUP00000004797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]