SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005005 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005005
Domain Number 1 Region: 1150-1372
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.2e-61
Family DBL homology domain (DH-domain) 0.0000000246
Further Details:      
 
Domain Number 2 Region: 218-321
Classification Level Classification E-value
Superfamily EF-hand 4.56e-28
Family Eps15 homology domain (EH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 1372-1513
Classification Level Classification E-value
Superfamily PH domain-like 4.4e-26
Family Pleckstrin-homology domain (PH domain) 0.00000185
Further Details:      
 
Domain Number 4 Region: 1085-1150
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-25
Family SH3-domain 0.0000467
Further Details:      
 
Domain Number 5 Region: 3-96
Classification Level Classification E-value
Superfamily EF-hand 4.18e-24
Family Eps15 homology domain (EH domain) 0.0014
Further Details:      
 
Domain Number 6 Region: 1527-1647
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.86e-20
Family PLC-like (P variant) 0.0055
Further Details:      
 
Domain Number 7 Region: 853-940
Classification Level Classification E-value
Superfamily SH3-domain 6.56e-18
Family SH3-domain 0.0000247
Further Details:      
 
Domain Number 8 Region: 944-996
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-18
Family SH3-domain 0.0000978
Further Details:      
 
Domain Number 9 Region: 1015-1079
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000249
Family SH3-domain 0.0000276
Further Details:      
 
Domain Number 10 Region: 777-825
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000214
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005005   Gene: ENSMEUG00000005439   Transcript: ENSMEUT00000005489
Sequence length 1657
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9658:874:75256:-1 gene:ENSMEUG00000005439 transcript:ENSMEUT00000005489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPTMWAITSEERAKHDKQFDSLRPAGGHITGDQARGFFLQSGLPAPVLAEIWALSDLNKD
GKMDQQEFSIAMKLVKLTLQGQRLPPSLPPIMKQPPVFSPLASARFGMGSMPNLSIPQCV
PPAAPMAPMSSRPSVTSLPPLGMPAPLVPSVSTSSLPNGTAALLQPMTVPFSSATLPHTS
SYSLLMGSFGGSCIQKAQSLIDLGSSSSTSSTASLTGGSPKAGSSDWAVPQPSRLKYRQK
FNSLDKGMTGYLSGLQARNALLQSNLSQTQLATIWNLADVDGDGQLKAEEFILAMHLTDM
ARAGQPLPLTLPPELVPPPFRGGKPVDSLNGTQPCHERTQEEPPQKKLPVTFEDKRKANY
ERGNLELEKRRQVLLEQQQREAERKAQKEKEELERKQRLLQEHEWRRQLELEKQRELERQ
REEERRRDAERREAAKQELERQRRLEWERIRRQELLSQRNREQEEIVRLQARKKGLHLEL
EALNGKHQQISGRLKDMRERKQTRRSELDVLDKQCELGVLEITQLQQQLQESQNQLVYLV
PEKQRLQEKIQHLQPDSSAHLGIGAIHKKSLEKEGLCQRLKEQLDALERETAAKLSEMDA
FNSELKCVTVDDSMLRCLLSLLSCLHHLFLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDENTTGEPG
WLYGRFQGHWGWFPGNYVEKVSAGEAVSPKKALLPPPASLSTTSSASLESRPSGQPTAET
NYQNVPFSTLTANASWQKKSAFTRTVSPGSASPIHGQGQTVENLKAQALCSWTAKKENHL
NFSKHDIITVLEQQENWWFGSVHGGRGWFPKSYVKIIAGPETRKEYVALYSYSSSEPGDL
TFTEGEEILVTRKDGEWWTGTIDNRAGIFPSNYVRAKEAEALGSASRAGALNKKPEIAQV
TSAYVASGAEQLSLSPGQLILILKKNPSGWWQGELQARGKKRQKGWFPASHVKLLGPGND
RGTPACPPACQVIAMYDYVANNEDELNFSKGQLITVLNKDDADWWHGEIGGTTGLFPANY
VKMTTDSDPSTQWCADLQSLDTMAPMERKRQGYIHELIRTEERYMDDLQLVTEVFQKRMA
ESGRLSEGEMALIFVNWKEIIMSNTKLLKALRVRKKTSGEKMPVQMVGDIVAAELSHMQA
YIRFCSCQLNGAALLQQKTDEDADFKEFLKRLARDPRCQGMPLSSFLLKPMQRITRYPLL
IKNILENTPESHVDHSSLKLALERAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLAEQ
LVFNSLTNCLGPRKLLHCGRLYKAKSHKELLGFLFTDFLLMTQATRPFPAAAGPDKLFST
KSSAQFKMYKMPVFLNEVLVKLPTDPSSDEPIFHISHIDRVYTLRVDNINERTAWVQKIK
GASEQYIETEKKRREKAYQARSQKSSGIGRLMVHIIEASELKACKPNGKSNPYCEISLGS
QSFTTRTLQDTLSPKWNFNCQFFIKDLYQDVLCLTXXXXXXXXXXXFLGRTEIPVAKIRT
EQESKGPTTRRLLLHEVPTGEVWVRLDLQLFEQKTLL
Download sequence
Identical sequences ENSMEUP00000005005 ENSMEUP00000005005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]