SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005028 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005028
Domain Number 1 Region: 131-245
Classification Level Classification E-value
Superfamily C-type lectin-like 3.61e-29
Family C-type lectin domain 0.0000052
Further Details:      
 
Domain Number 2 Region: 101-126
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000353
Family Triple coiled coil domain of C-type lectins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005028   Gene: ENSMEUG00000005512   Transcript: ENSMEUT00000005518
Sequence length 245
Comment pep:novel scaffold:Meug_1.0:Scaffold1034:46488:51782:1 gene:ENSMEUG00000005512 transcript:ENSMEUT00000005518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLFSLVLTLTLLVPPGHGMDLCSGSPGIPGTPGAPGLPGRDGRDGIKGDPGPPGPMGPS
GGLPGLPGKDGLSGAPGSAGERGEKGEKGETGPPGLPAYLDEELQSVLQDFRHHILQSMG
VLNLQGTMLHVGKKVFSTNGQSMNFQGINEICAKAGGTIATPRNEEENSAIMNFVKKYNT
YAYLGLTEGKTPGEFYYLNGSLVEYTNWYPGEPAGKGLEPCVEMYTDGTWNDRSCLQYRL
AICEF
Download sequence
Identical sequences ENSMEUP00000005028 ENSMEUP00000005028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]