SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005053 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005053
Domain Number 1 Region: 375-594
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-52
Family DBL homology domain (DH-domain) 0.00038
Further Details:      
 
Domain Number 2 Region: 586-715
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000113
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005053   Gene: ENSMEUG00000005521   Transcript: ENSMEUT00000005545
Sequence length 816
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9741:2213:11614:1 gene:ENSMEUG00000005521 transcript:ENSMEUT00000005545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPSLPPATPPSQKPPRVTRPHPPSRLRTNPLPRSFFNGSSPQAVASNDPLILPTLCDS
LPTSTKPIRPSTPSPKSSSLSLAQPESSSRSPSPQALSPGLPKLLSPFPAPQINFPEPIS
PSQSSSPKSLSLPHHPSASGTVRRLAGRFEAGSTVGDQVGEAPLPCLQGGVNENGEKEDC
HDPLAGSGAQENGCLDTPLSCPPRCPCLCHLAHPGLELKWVSVGDSEEVPQASSLPTRSL
PSPPSNKNTSVVLTSYRSMVEHKLLPPLTPPKPTWTKKEATCPEHPPQTDSNLPSKDETY
PGDNVNPKTSVGRDQELEVLNEEDWGLPLQDVPFPQSYQTAVLAEELWGVGKDGKLLPTN
LREPTEPRNTLWQELPTVRESGLLKTLSPQERRMQESLFEVVTSEASYLRSLQLLMDTFV
LSTSLRDTLTPRDHHTLFSNVHRVQGVSERFLGVLLSRVRSSPHISDLCDVVHVHAEGPF
SVYVDYVRNQQYQEETYRRLMETNMRFSAELHRLQSLPQCQRLPLPSFLLLPFQRITRLR
MLLQNILRQTEEGSSRRENAQKALGAISKIIERCSAEVGRMKQTEELIRLSQRLRFHKVK
ALPLVSWSRRLELQGELMELGSRKGRSLFNSRPRLTPLCLLLFSDLLLITQPKSGQRLYV
LDYAHRSLVQAQPVPDPSGPPTFRLSLLSNHQGCPTHRLLQTSSLSDMQRWLGAFPTPGP
PPCSPDTIYEEWDCPQALSINSHGTANTKDLDLESGNFANQLHKSPEAWLKGIHGSYAAQ
LASEVTGEHTRRKNLQQQKQLLREAGKPTSNAHTLP
Download sequence
Identical sequences ENSMEUP00000005053 ENSMEUP00000005053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]