SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005079 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005079
Domain Number 1 Region: 514-704
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.52e-56
Family Eukaryotic proteases 0.00045
Further Details:      
 
Domain Number 2 Region: 328-429
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000722
Further Details:      
 
Domain Number 3 Region: 216-317
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 4 Region: 1-102
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0027
Further Details:      
 
Domain Number 5 Region: 159-213
Classification Level Classification E-value
Superfamily SRCR-like 5.1e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005079   Gene: ENSMEUG00000005555   Transcript: ENSMEUT00000005573
Sequence length 705
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_7013:17342:68138:-1 gene:ENSMEUG00000005555 transcript:ENSMEUT00000005573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVRLRGGKNEFEGTVEVYSRGVWGMICSSDWDDGAASVICRQLNFGAKGTAKQTPMSERG
LLPIHWSSTHCRGDEDNILLCETDTLGGTCPQRMVAAVSCSFYQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVAKAWSRAYFGPGSGSVMLDEVQC
TGNELSLEQCPKSAWQHHNCDHREDAGVSCTPLTDGALRLTGGKGSHEGRLEVHYRGRWG
TICDDGWTEKNTQVACRQLGFKYGKQACSRHFEESGPIWLDDVHCSGKETAFLQCSRGKW
GEHDCSHREDIHITCHPDNDVNRFSLGLPIRLMDGENKKEGRVEIFVNGQWGTICDDGWT
DKDATVVCRQLGYKGPARARTMAYFGEGKGPIHADNVKCTGSERNLADCIKQDIGKHNCR
HSEDAGVICDYFVKKASGHSNKDSLSSVCGLRLLHRRQKRIIGGKNSLRXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGNNTRNYIVRVGDYHTLVPEEFEEELGIQ
QIVIHRQYRPDSSDYDIALVRLQGPEEQCATFSSHVLPACLPFRRERPQKTAPNCYITGW
GDTGQAYSRTLQQAAIPLLPKRFCEERYQSRFTGRMLCAGSLQEQNHVDSCQGDSGGPLM
CQRPGESWAVYGVTSWGYGCGVKDSPGVYTKVSAFIPWIKSVTKL
Download sequence
Identical sequences ENSMEUP00000005079 ENSMEUP00000005079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]