SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005087 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005087
Domain Number 1 Region: 212-342
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-37
Family DBL homology domain (DH-domain) 0.00072
Further Details:      
 
Domain Number 2 Region: 323-469
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-30
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 434-474,509-565
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.24e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005087   Gene: ENSMEUG00000005553   Transcript: ENSMEUT00000005583
Sequence length 619
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_3809:2163:54912:1 gene:ENSMEUG00000005553 transcript:ENSMEUT00000005583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGLSSSPSPSTVDALGKPANCAGHCRAILGKIKELHIGDSQSFEDCSSVKLNKEAMGR
DGKSPTVEQSSNGKIPNRDSGIDSPSCSVAGEAFPAEEGETAPGLLTELKENRMAHLDTQ
KEVAQEADSDVDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTNPRIGDILQKLAPFLKMYGEYVKNFDRAM
DLVNTWTQRSSPFKDVVQSIQKQEICGNLTLQHHMLEPVQRIPRYEMLLKDYLKKLPGES
PDRKDAEKSLELISTAANHSNAAIRKMEKMHKLLEVYERLGGEEDIVNPANELIKESHIQ
KLSAKNGSAQDRYLFLFNSMLLYCVPKLRLIGQKFSVREKMDIAGLQVQEIAKPNATHTF
TITGKKRSLDLQTRTEEEKKEWIEVILATIEKHKQKSETFRAFNTSFTQEEDVPDSPXXX
XXXXXXXXXXXXXXXXXXLDSRKSSKNRRDKEKQTCKSCSETFNSITKRRHHCKQCGAVI
CGRCSEFRADNSRQSRVCKECFLMQTTVPNSPVKQNITAPENSLFCSHLQLIDKGKVCCK
LWATIPKAEPLVLYLQGGQ
Download sequence
Identical sequences ENSMEUP00000005087 ENSMEUP00000005087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]