SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005277 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005277
Domain Number 1 Region: 607-669
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 0.000000000000275
Family Oxysterol-binding protein 0.0051
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000402
Family Pleckstrin-homology domain (PH domain) 0.053
Further Details:      
 
Domain Number 3 Region: 484-545
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 0.00000000000262
Family Oxysterol-binding protein 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005277   Gene: ENSMEUG00000005786   Transcript: ENSMEUT00000005797
Sequence length 671
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5485:4277:98100:-1 gene:ENSMEUG00000005786 transcript:ENSMEUT00000005797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFMLDFESGILQYFVNEQSKSQKPRGALSLAGAIVSLSDEAPHMLVVYSANGEVYKLRAA
DAKEKQCWVTQLQNCAKYHMEAHSKSPPSSRSRSLTLLPHGTTSNSSSPSSQRHLTPAPP
TVVTVTHHKSPAAARRSKSHYSAQLHDVREMMSQVEGQQKTLVRAIEALPGSGPLTPLDQ
DLLLLKATSAATLSCLGECLSLLQQSIHQVGQYNHRTGPSENLGWHSPKSHSTDQLRNGA
VGLPPSSGSSITWADLPSSSGSKDPPSKPEPEXXXXXXXXXXXEEETDKEESGEDGSSES
EDHRSIVLHLISQLRFGMDLTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXILRLLDYEEDYVFTLPNAYARSILTIPWVELGGQVTMDCAKTGYTAQVTFHTKPFYG
GKVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXNLWREVTNAIKQGDMNGATEFKRSLEDKQRKEEQQRDILHAEWRPKYFNKEGEG
WMYSEPLLKFQ
Download sequence
Identical sequences ENSMEUP00000005277 ENSMEUP00000005277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]