SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005492 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005492
Domain Number 1 Region: 456-746
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.19e-50
Family Eukaryotic proteases 0.000022
Further Details:      
 
Domain Number 2 Region: 286-453
Classification Level Classification E-value
Superfamily vWA-like 5.04e-34
Family Integrin A (or I) domain 0.000052
Further Details:      
 
Domain Number 3 Region: 82-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 4 Region: 148-204
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000126
Family Complement control module/SCR domain 0.00044
Further Details:      
 
Domain Number 5 Region: 23-90
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000186
Family Complement control module/SCR domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005492   Gene: ENSMEUG00000006004   Transcript: ENSMEUT00000006028
Sequence length 754
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9832:11678:24155:1 gene:ENSMEUG00000006004 transcript:ENSMEUT00000006028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFLHALLLLPLYAGLSITAPSCSRNVKILGGNFTLSDGWAPGSRLIYTCPVGRYPDPVS
RLCNSNGQWKSSGTSEFTKAVCKYVRCPAPVVFENGVYSPRMKSHPVGGNVSFECEDGYI
LRGSPVRHCRPNGMWDGETALCDNGAGHCRDPGIPIGSVRTGYRFNVGDRVKYRCSEKLI
LIGSEERECQANGVWSGTEPICRSSYSYDFPEDVAPVLDTSFSQLLGATNPLMQKSXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFSFEVNVSVGIVTFAKTP
KVILSVTHRDSREDMEVVRKLEEIKYGDPDIGTGTNIYRALKQIYDMMNNEMAIYGKRQK
EWEEIRHVIILLTDGKSNMGGSPKAAVDLIEELLNIKANRNDFLDIYAIGVGKLDVDWKE
LNELGSKKDGERHAFILSDAKALLQVFENMLDVSKFVDTICGVGNMSTNASSQERTPWHV
IIKPSSKETCRGALISDQWVLTAAHCFHTHDNTKLWRVIVGDPKSKRGSEMQIDQHFVPE
EYNVYAKKNQGIFEFYGSDIALLKLTEKVKMSSHARPICLPCTVGANLALRRSPASTCLD
HENELLKKNEIPAHFVSLDDKIMDIVLKEENERAFCLQAVFQAKDLFPNLTDVKEVVTDQ
FLCSGAGNEASPCKGESGGAVFLQKKYRYFQVGVVSWGLHNPCLKDNKPCPEDSRPKGET
LAPGSKARDFHISLFRLQPWLRQHLKNVLRFLPL
Download sequence
Identical sequences ENSMEUP00000005492 ENSMEUP00000005492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]