SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005608 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005608
Domain Number 1 Region: 871-1051
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Domain Number 2 Region: 1026-1139
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.09e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 10-162
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-23
Family Phosphotyrosine-binding domain (PTB) 0.0078
Further Details:      
 
Domain Number 4 Region: 369-419
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000492
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005608   Gene: ENSMEUG00000006120   Transcript: ENSMEUT00000006153
Sequence length 1141
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4574:33884:109508:-1 gene:ENSMEUG00000006120 transcript:ENSMEUT00000006153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALPSPGLGKPGEKQFRLWYVGWSCLDRRTTLPMLPWLMAEIRRRGQKPGAGAAREVLLLL
SSPHLRCVPVPSGGSGAPGASPSAPGPLPSPSVFIFEHKAQHISRFIHNSHDLTYFAYLI
KAQPDDPESQMACHVFRATDPNQVPDVISSIRQVSKAALKEDAKPNKDSEDAFYNSQKFE
VLYCGKVTVTCKKAPSTLIDDCIEKFSLHEQQRLRLLSEQRSSDSSNDLMVFESEAPISP
ADGQSEELDDNLSCFGLTMVVGQPSLSSSRVCFPERILEDSGFDEQQEFRSRCSSVTAVS
QKKVHDGPLKVQPRRRHASAPSHVQPSDSEKNRTMLFQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXGIKHVDHFGFICRESPEPGLSQYICYVFQCASESLVDEVMLTLKQAFSTAAA
LQSAKTQIKLCEACPMHSLHKLCERIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGANRMRGRLGSMDSFERSNSLASEKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILPS
GRCIHKESKSSSSSLPSLHTSMSAPSFSAPSFLKSFYQSSGRLSPQYENEIXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLDRNE
LLPLSPLAPTMEEEPLVLFLPGEDEPEKVDGRRKSEELRSLWKKAIHQQILLLRMEKENQ
KLEASRDELQSRKVKLDYDQVGVCQKETLLTWDKKLLNYRTKIRCDMEDIHMTLKEGVPK
SRRGEIWQFLALQYRLRHRLPSKQQPPDISYKELLKQLTAQQHAILVDLGRTFPTHPYFS
VQLGSGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFR
KQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFPLGFV
ARVFDIIFLQGTDVIFKVALSLLSSQETLIMECENFENIVEFLKNTMPDMNTSEMEKIIT
Q
Download sequence
Identical sequences ENSMEUP00000005608 ENSMEUP00000005608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]