SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005703 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005703
Domain Number 1 Region: 455-585
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.24e-22
Family Ricin B-like 0.0044
Further Details:      
 
Domain Number 2 Region: 128-183
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000000366
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005703   Gene: ENSMEUG00000006241   Transcript: ENSMEUT00000006259
Sequence length 600
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_10223:3351:84928:1 gene:ENSMEUG00000006241 transcript:ENSMEUT00000006259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRKQKRFLQMTLLFMVALIFLPNIGLWSLYKDKHLMKSTGPGEQQTFPLDLGDGQLYTW
TDGLKRKDWHDYGSIHKDALRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXCKHKMYLEKLPNTSIIIPFHNEGWTSLLRTIHSIINRTPDSLIAEIILVDD
FSDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXQIALNRKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQR
ADPSDPFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRNVAANLCVDSKHGATGTELRL
DICVKDGSERTWSHEQLFTFGWREDVRPGEPLHTRKFCFDAISHSSPVTLYDCHGMGNQX
XXXXXDKTLFHPVSNSCIDCNPSEKKIFMNRCDPLSETQQWIFEHINMTILEKVNSNISS
Download sequence
Identical sequences ENSMEUP00000005703 ENSMEUP00000005703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]