SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005725 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005725
Domain Number 1 Region: 291-511
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-52
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 652-715
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-16
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 512-639
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000541
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005725   Gene: ENSMEUG00000006256   Transcript: ENSMEUT00000006283
Sequence length 738
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5253:932:15986:-1 gene:ENSMEUG00000006256 transcript:ENSMEUT00000006283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELPPPARHPVAVCQQESLSFAELPALPAGHWSLEVPAASHGLPWPLGGSAGSRPYWEVIS
LWRCPSEFLGGPRSPQHPEPQRRTSHSSEKKSAWRKMRVYQSQEATGSTSAEDDAVFADV
GTEVPELHPSLEVPKTLAVAVTPRAGAKEPERRRFSASELMSRLQSARRAPEKESSCSEM
RVDGLMSPAISGEGSWSDTRTDLRQEPAPKAWVPHERRQSRFLLNSVLYQEYSDVASDRE
LQRQKHEDDNWGEEAEEEEEGPGPPRANLSPSSSFRAQRSARGSTFSLWQDIPDVRSSGF
LAVIGLQERKLQEAKFELITSEASYIHSLSVAVGHFMGSSELAECLGAQEKQWLFSKLSE
VKATSERFLQELEQRLEEDILRFCVCDIVLRHCPAFRRVYLPYVTNQAYQERTYQRLLLE
NPKFSSILARLEEAPVCQRLPLTSFLILPFQRITRLKMLVENILKRTGQGSRGEDMATKA
FNELKKLVQECNASVQSMKRTEELIHLNKKIHFESKIFPLISQSRWLVRHGGLVELAPPT
MPAVSAAKPKLSTKAIYLHVFNDCLLLSRRKEMGKFAVFLYARMPEIQVKDLSSKLQGIP
GQVFLLQFLHSHQPRNQVLLRAQTESEKQRWISAMCPSSAQEDKEAISENEDLPQVQCIR
AYKALEPDELTLEKADILAVRTRTSDGWLEGIRLADGERGWVPQAYVDEITSRSARLRNI
LETRRIENATNKLQETTA
Download sequence
Identical sequences ENSMEUP00000005725 ENSMEUP00000005725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]