SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005897 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005897
Domain Number 1 Region: 91-304
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-60
Family DBL homology domain (DH-domain) 0.00000000299
Further Details:      
 
Domain Number 2 Region: 289-443
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000581
Further Details:      
 
Domain Number 3 Region: 9-106
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000801
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005897   Gene: ENSMEUG00000006463   Transcript: ENSMEUT00000006478
Sequence length 512
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4073:36249:97109:-1 gene:ENSMEUG00000006463 transcript:ENSMEUT00000006478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMLISGGSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWCWAQIDDEEGSSFVRL
WVNQEDGVEEGTSEVQNGHLDPNADCLCLGRSLQNRDQMRANVINEIMSTERHYIKHLKD
ICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNEDPHLSEIGPCF
LEHQDGFWIYSEYCNNHLDACMELSKLMKDGRYQHFFEACRLLQQMIDIAIDGFLLTPVQ
KICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASV
LDWEGEDILDRSSELIYTGEMSWIYQPYGRNQQRVFFLFDHQLVLCKKDLIRRDILYYKG
RIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKLRWLRAFREER
KMVQEDEKIGFEISENQKRQAAMTVRKVSKQKGANYSRAVPPAYPPPQDPVSQGQYLVTD
GITQSQVFEFSEPKRSQSPFWQNFSRLTPFKK
Download sequence
Identical sequences ENSMEUP00000005897 ENSMEUP00000005897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]