SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000005925 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000005925
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000553
Family C-type lectin domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000005925   Gene: ENSMEUG00000006490   Transcript: ENSMEUT00000006508
Sequence length 110
Comment pep:novel scaffold:Meug_1.0:Scaffold24516:6875:8127:1 gene:ENSMEUG00000006490 transcript:ENSMEUT00000006508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEWPALRSSCPQGFGFYDSHCWFVGLGETCNTVLPCYTRDSGHLGSLLNEVEAFFMATMI
VENEIGQNPVWFELHDPNKNHRWLSFYQAWEKGSLGRTNPNYCVSLTPQS
Download sequence
Identical sequences ENSMEUP00000005925 ENSMEUP00000005925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]