SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006172 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006172
Domain Number 1 Region: 94-419
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 8.25e-54
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000506
Further Details:      
 
Domain Number 2 Region: 427-558
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000000000505
Family Ricin B-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006172   Gene: ENSMEUG00000006752   Transcript: ENSMEUT00000006780
Sequence length 572
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_3958:383:41255:1 gene:ENSMEUG00000006752 transcript:ENSMEUT00000006780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSMKYTRMQKEMKQAWAVTKASRRPEDEGKQAPITLENRTKKEPEHKSPRELFPGSLLFR
RWGEDLTESQQTLAYDLFMQFGYNVYLSDRLPLNRSIEEFRGPRCLQKQYPQHLPTLSVV
LTLMNEAMSVIHRAIISIINRTPSHLLKELILVDDFSSNEELKRNLDKQIQLYKKKYPKL
LKLIRHTKRRGLTQARLSGYQAATADVVAILDAHVEVTTGWAEPILARIQEDHTVIISPT
LDGISYDTFKVIQYPTFPIGFDWKLWCLIDYMPMDWYFLNDESAPVKSPSVMGIFAANRL
FLRKIGSLDAGMMIYGGENVELSFRAWQCGGKIEILPCSRIAHLQRAHKPYSLNFTSMKR
NALRVAEIWMDKYKYMVYLAWNLPLENHGIDYGDVSSRKELRKKLNCRSFDWYLKNVYPS
LKPIRNIVGYGTMKNTVDEMICLDQGPVSGKIPVMHICHGYETQLIFYSRTGEFYVGCLF
AENVGDWCLIDQGQGHWSILETCTEPINGELYMYWDFKQGAAIINKDTKRCLEIQQDDTR
SYTLILQECTGQVWNIQHIVQDWKNSQTEASK
Download sequence
Identical sequences ENSMEUP00000006172 ENSMEUP00000006172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]