SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006303 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006303
Domain Number 1 Region: 228-346
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-30
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000006303
Domain Number - Region: 80-119
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000116
Family DBL homology domain (DH-domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006303   Gene: ENSMEUG00000006887   Transcript: ENSMEUT00000006931
Sequence length 1139
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_3800:12792:25992:1 gene:ENSMEUG00000006887 transcript:ENSMEUT00000006931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSVSLHQDATQERPVSLASTTSSSGSSRDSQAMEEPNGTGPVAEGESGSPHACHIPNS
HNNSNSWLNLRGSLKGSPFSSRSAPGPGHHKLSYLGRVVREIVETERMYVQDLRSIVEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIQSLLINWKGP
DLTTYGELVLEATFRVHRVRNERTFFLFDKALFITKKRGDHFVYKGHIPCSSLMLIESTR
DSLCFTVTHYKHSKQQYSIQAKSVEEKRAWTHHIKRLILENHHATIPQKXXXXXXXXXXX
XPNRYRYSPERLKKAWSSQDDMPTQVRQHRRQSEPTKQLLRQINEKARASGLKVKGHDEY
EVVKGYKRPSGQSLTSPEKRMSFESVSSLPEAEPDTEPDASQELFPATEGNSGEVMQSDT
ESSCILEQQHQEELGSDHPVKVVDHAVAESTEDLKNLSSEEEEEVTAEPESILPTSVLDQ
ASIIAERFVSTFSRRNSLALEDGKASGFLTPRLVSRSSSVXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSTRDRLLLDRIK
TYYENAEHHDAGFSIRRRESLYIKGLVRNSVFRFNSLLPEPKPVAPVGRKRIDGSRPASW
TLFDLPGPDQAGSRDPPPITDAEFRPSSEIVKMWEGMESCGDICKKESGLSQENGFDLHE
PLFILEEHELGAISEEPVGSSLEGITLTDQAGPAQLARELKELVKELSARDEELPAPLHP
HIMQFSHMMDRDLTERVKNKVYQLARQYSLRIKSHKPTMPQRKKVDPEQEKKLTLPHLRE
EIRELPCKGKMKPSLSLSNNEQVMVLEHDPSKSTSAREKSPRRFYSPSAGSKAISPGGWS
SNRSPLSPVDTETFHWPDVRELCSKYASHDEATQAGRGQRQSPPVNRSFSVPDNIMEPTR
VGKMSRCCSLNTHKSRRTQEITQPPWLLPQGDVDEALYLTADLTLENNRRVIVLEKGPTT
GRRKSSAQERSPAVVEMQGFQESQDFCWQEEGSRGPADMGQQGRVRNLRERFQTLNSNG
Download sequence
Identical sequences ENSMEUP00000006303 ENSMEUP00000006303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]