SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006325 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006325
Domain Number 1 Region: 1624-1748
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-32
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Domain Number 2 Region: 1508-1624
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-25
Family DBL homology domain (DH-domain) 0.00077
Further Details:      
 
Domain Number 3 Region: 1196-1259
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000006325
Domain Number - Region: 51-107
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00186
Family Ankyrin repeat 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006325   Gene: ENSMEUG00000006896   Transcript: ENSMEUT00000006953
Sequence length 2231
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_7907:25471:153321:1 gene:ENSMEUG00000006896 transcript:ENSMEUT00000006953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNFTRFLDRSGPPSGDVNSLDEKVALAFRHLLPEEWNVLGTDPALNDGGPRETLMHFAVR
LGLLRLTWFLLQKPGGRGALSIHNNEGETPASLALERGYQKLHRLLTXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDPEGD
NQGPEVPCSIAILNKDNLAQDLKLDTPSPLKHKLVSPSDPALIEAKESFILDQAMTSENH
FTQPGRLSVESATEDDAISSVPPQQEKGTATPEKKAEECSCDPAGALVPNNLPTEDSVGS
LPAFFPTPDPQLSMGNSSSIEGGQRDEGLNDKRNADSFIPNERTATLPADSVLSGADREP
LGPESTIAWEQDKENEAAAKDDLLCSISLPKEETPPPGEETSGLGDQPVLVPCAEGKILK
TNNSVGTPSAILNVEPEQNKEVAAKVSLRAEQSTAVQCQVPLEAGLSADRQKTFGSGECN
LLWPAVTSKTDEPQTCDREKTVSAKPEVKETQSKRDSSSYEECVNVTVGSREEATEDPSV
LGTKDVSSGHQDVLVQKNMADQENDIILGLPGAPPEGEILEKETVIMEMLLASKEKGEAD
EIIPIERHLKETEVDSVVPRVLLQPIAEELLSDMVPLSDEGDTMSCVNKTKEILPDGDGV
IPSQSVLAQADVTDSLERENLIEETANRLVDTVLEKVRATGGVVTMGENSSPPQCDAPEP
SPVTEELEKVPGMDAKEELGINSEVWTTEGEEQEKISGYSQAPEPVTEMPDMKAEDEVDF
LDNSREDSISEEMDVAKHKRKHRIKTQMXXXXXXXXXXXXXXXXXXXXXXXXXXCENFLE
VGLGGECASSQGVLQRQSGSDSDLFPSPGDEMDDSIIFTKPEEEQSVCDITGSSSSTDDT
ASLDRHSSHGSDISLPQIRNLNRTKDRQSLDGFYSHTVGVEGRESESEPAESGEMEEEEM
DSITEVPTNCSVLRNSMRSLSPFRRHSWGPGKNAASDAEMNHRSMSWCPSGVQYSAALSA
DFNCRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXSRQRSKQQGFNYCTSAMSSPLTKSISLMTISHPGLDNSRPFHSTSASLTE
SVTEQVPFRKDPDWKSVTKVSRTFSYIKNKMSSSKKSKEKEKDKDKVKEKEKDSKEKERD
KKMLNGHTFASIPVVGPITCSQCMKAFTNKDAYTCANCGAFVHKGCRESLASCAKVKMKQ
PKGSLQAHDTSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVGNDESMANTWKFLSHSTDSLNKISKVNESTESLTDEXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXKTYGKFCGQHNQSVNYFKDLHTKDKRFQAFVKKKMSSAVVRRLGIPECILL
VTQRITKYPVLLQRILQCTKENDLEQEDLAQSLSLVKDVIGAVDSTVANYEKKVRLNEIY
TKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGSVFLKSSAGRLKEVQAVLLTDILVFLQEK
DQKYVFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMKDPEMVEVHASSKEERNSWI
QIIQDTINALNRDEDEGIPSENEEEKKLLDAKARELKEQLQQKDQQILTLLEEKEMIFRD
MTDCSMPLSEDSSPTHGSRVLFRSNTEEVPKGGPIMKSAINEVEMLQGLVSGSLGGTLGQ
SISSTLEQEGGIVGPVSLPRRAETFGGFDSHQMNASKGGGEKEDGDDGQDLRRTESDSGL
KKGGNANVVFVLKRNSEQVIQSIIHLHELLSTLQGVVLQQDSYIEDQKLMLSERAVTRSS
SRPNSLIEQEKQRSLEKQRQDLANLQKQQAQHLEEKRRREKEWEAREKELTEREARLTHG
EEKVQRGQQDLDKEREELQQKKAAYQSDLERLRAAQKQLEKEQEQVKREMERLSQRQAEH
DANQVSHQHGKLMRIPAFFPNPEEPSQLTASSISQSGSLDSELSISPKRNSISRTHKDKG
PFHLLSSSSQASKVSEGQSQIPVSTSTSTRLFGLAKPKEKKEKKKKSKGGRSQPGDGHSP
EAPAEGEEIFC
Download sequence
Identical sequences ENSMEUP00000006325 ENSMEUP00000006325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]