SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006350 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006350
Domain Number 1 Region: 1219-1333
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-33
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 1021-1201
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-21
Family DBL homology domain (DH-domain) 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006350   Gene: ENSMEUG00000006940   Transcript: ENSMEUT00000006980
Sequence length 1474
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_7296:1259:22086:1 gene:ENSMEUG00000006940 transcript:ENSMEUT00000006980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYALDFLVPAKHLLAR
VQQEACAQYSGFLFLHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSVARAPHLAL
KCLAPGGGRVQELPVSTEACAYLFTPEWLQGINKDRPAGRLTTCLLASPTGVQRLPWAEL
ICPRFVHKGSLMVGQRPVSLPPELPPGAPGLSSPPLPEEALGTRSPGDGHNAPAEAPEGE
YVELLEVTLPARGCPGDATSSPGLSRTQTVPARKGAGGKGRHRRHRAWLHQKGTVPRGQD
GTRPPGEGSSTGINTGSPLAESLKKTDAPEPAEALGGEAGSXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDS
NMAWDLMASGFFMLTGGVDQSGRALLTITPPCPSIEPPPTQAEMSTVLCYLHSLLRSDLK
TLGLSVLLDLRCAPLPPGLITVLNDLQDSKEHPVIQRLMILTENESHPELSDLQGAELLS
ESDLPTVAKPEELQKDLGGQRILSPQRWTETHQEVARLGQLCHDVLCSVREAIEELEEAA
EPEGEVEVGTPEPLQKVLADPRLAELQRDGGAILMKLRIAHSSRLEGPGPAILYQEVDEA
IHQLVRLSNLYLQRQENQRRQHRLLQVLQWLSGPGEETLMSFTELGDSLPALQETEMRFQ
AFSTEVQEQLAQAREALTLEEDPTTQQPLDDFEQRLEQVESSLHRALRLHRFFQQAHEWV
DEGTAKLAGAGPGQEAVLAALAPVPSVGTFQEMRALALELGSPAALREWARCHARCLELE
RRIQEFLGDETSPQGRCRRRADSASSGRGKQDPLSPSRSLSLLLLPNSPGPRPAPSHCSL
APCGEDSEEETQELAPDAQGKPRPGTTRAVLIRGLEVSSTEVVDRTCSPREHVLLGRAGV
PDGPWGVGTPRMERKRSISAQQRLVSELISCEQEYVTVLGEPVPPPGPELTAELRVDWAA
VLGARERLRSFHRVHFLRELQGCAAHPLRVGACFLRHGDQFNLYAQYLKHRHKLEAGLAA
LNPPNKGSTEGGPYLPRFLQQPLEQLARYGKLLEELLKETGTELSSERQALAAALQLLRD
QEDRGRDLLAVEAVRGCEVDLKEQGQLLHRDPFTVFCGRRKCLRHVFLFEHLLLFSKLKS
PEGGPEVFVYKQAFKTADMGLTENIGDSGLCFELWFRRRRSREAYTLQATSSDIKHKWTS
SIAQLLWRQAAHNKELRVQQMVSMGIGNKPFLDIKALGERTLSALLTGRAARTRASVAVS
SFEHVGPSLPCLSPGACSLPARVEEEAWDLDIKQISLAPESPDSSGEVSPGARSSPSLQS
PNLGSSTPILPSGGILGYARTSHTRAPSDPTTPL
Download sequence
Identical sequences ENSMEUP00000006350 ENSMEUP00000006350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]