SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006353 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006353
Domain Number 1 Region: 262-418
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-39
Family DBL homology domain (DH-domain) 0.0000000676
Further Details:      
 
Domain Number 2 Region: 494-577
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-24
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 2-139
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.01e-21
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006353   Gene: ENSMEUG00000006943   Transcript: ENSMEUT00000006983
Sequence length 795
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1853:7242:139285:1 gene:ENSMEUG00000006943 transcript:ENSMEUT00000006983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQSSLKDGVVLCRLLDRLLPGTIEXVYPEP
RSESECLSNIREFLRGCGSSLRLEXXXXXXXXXXXXXXXXXXXXXTFDANDLYQGQNFNK
VLSSLVTLNKVTADIGLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXKPVSPKSGALKSPPKGFDTSAINKSYYNVVLQNILETENEYSKELQTILSTYLRP
LQSSEKLNSTNILYLMGNLEEISSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLAYCANHPSAVNVLTEHSEDLGEFMEMKGASSPGILVLTTGLSKPFMRLDKYPTLLELE
RHMEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXEKNERYLLLFPNILLMLSASPRMSGFIYQGKLPMTGTTITKLEDSEN
HKNAFEIAGSMIERILVSCNNQQDLHEWVDHLQKQTKVTTIGNPTVKPHSVPSHTXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXPSHHGTHTTINWGPLEPPKSKPWSSCRAPLRSAALC
YKEDLSKSPKTMKKLLPKRKPERKPSDEEFALRKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXWQGTDLMHNHVLADDDQSSLDSVGRRSSLSRLEPSDLSEDSDYDSIWTAHSYRMG
STSRKSCCSYISHQN
Download sequence
Identical sequences ENSMEUP00000006353 ENSMEUP00000006353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]