SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006733 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006733
Domain Number 1 Region: 278-489
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-61
Family DBL homology domain (DH-domain) 0.0000000683
Further Details:      
 
Domain Number 2 Region: 474-629
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-50
Family Pleckstrin-homology domain (PH domain) 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006733   Gene: ENSMEUG00000007371   Transcript: ENSMEUT00000007392
Sequence length 692
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4555:39019:120964:1 gene:ENSMEUG00000007371 transcript:ENSMEUT00000007392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPSEGRLGEKLVCHSGKRVPPTVSIQRPFSTIENITWTFPFLPADRSPSETSHKTTTMSR
NHYASFDDLWLEKQRKRKLKKQTHLERGVHAGTLPKDLVKARMKMSLTSPVPLDILALKI
QPFSQSAPTCLDHKCWRERIPFSMIPDGALGVALEDELESEEDLYEDFRSSTHHYGHPGG
GGEQLAINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLRVNQDEPMEDYPAKAEDGKEADTGAKAQTSKDQMRTNVINEIISTEKDYI
KHLKDICEGYIKQCRKRADMFTEEQLKTIFGNIEEIYKCQKKFVKALEKKFNKDHPHLSE
LGSCFLEYQNDFQIYSEYCNNHPNACVELSKLAKVNKYVYFFEACRLLQKMIDISLDGFL
LTPVQKICKYPLQLAELLKYTNPQHRDFKDVEAALNAMKNVARLINERKRRLENIDKIAQ
WQSSIEDWEGEDVLARSSELIHSGELTRISQPQAKSQQRMFFLFDHQLIYCKKDLLRRDI
LYYKGRINMDDMEIMDLEDGKDKDFNISVKNAFKLHCSSTDESHLFCAKKPEQKLRWLKA
FENERKQVQLDQETGFSITEVQKKQAMLNANKQQSSGKPKAVNRPYYDFLMRQKHPTLPA
NLPQQQVFMLAEPKRKPSNFWQNISRLTPFRK
Download sequence
Identical sequences ENSMEUP00000006733 ENSMEUP00000006733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]