SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006886 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006886
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-35
Family Phosphotyrosine-binding domain (PTB) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006886   Gene: ENSMEUG00000007543   Transcript: ENSMEUT00000007562
Sequence length 331
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9760:32664:149454:1 gene:ENSMEUG00000007543 transcript:ENSMEUT00000007562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YIGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQ
KKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGSSNIFRCNVFKSKKKSQAM
RIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESEKNSDNSGDPARQLTGAEKASAATAEE
TDIDAVDIPLPGSDILEFSRGVTDLDAVGKEGDLLTDTKASLHHQENILTASPKMLLPSS
SQLPSVETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQ
LLLQNKDMLQHISLLVKQVQELELKLSGHDA
Download sequence
Identical sequences ENSMEUP00000006886 ENSMEUP00000006886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]