SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007348 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007348
Domain Number 1 Region: 1200-1224,1281-1569
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.24e-83
Family Myotubularin-like phosphatases 0.00000968
Further Details:      
 
Domain Number 2 Region: 856-998
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-16
Family GRAM domain 0.012
Further Details:      
 
Domain Number 3 Region: 1754-1827
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000509
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007348   Gene: ENSMEUG00000008012   Transcript: ENSMEUT00000008067
Sequence length 1830
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4305:14105:257259:-1 gene:ENSMEUG00000008012 transcript:ENSMEUT00000008067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAEGMGKIIQRFPQKDWDDTPFPQGIELFCQPGGWQLSRERKQPTFFVVVLTDIDSDRHY
CSCLTFYEADINLQGTKQEDIEGEEEVTGLIQPAEVFAPKSLVLVSRLDYPEVFRACLGL
IYTVHVDSLNFSLESLIANLCACLVPAAGGSQKLFSLGAGDRQLIQTPLHDSLPVTGTSV
ALLFQQLGIQNVLSLFCAVLTENKVLFHSTSFQRLSDACRALESLMFPLKYSYPYIPILP
AQLLEVLSSPTPFIIGVHSVFRNEVHELLDVIIADLDGGTIKIPECIHLSPLPEPLLHQT
QMALSLILHPDLEVADYAFPPPRTALSHSKMLDKEVRAVFLRLFAQLFQGYRSCLQLIRI
HAEPVIHFHKTAFLGQRGLVENDFLIKVLNGMAFAGFVSDRGPPYRSCDLFDELVAFEVE
RIKVEESNPLKMIKHIRELAEQLFKNENPNPHMAFQKVPRPTEGSHLRVHILPFPKINEA
RVQELIQEGLLKNQLAPPTSRVEKKCVVPAGPPVVSIMDKVTTVFNSAQRLEVVRNCISF
IFENKVLETEKTLPAALRALKGKAARQCLTYELGLHVQQNRAILDHQQFDYIVRMMNCTL
QXXXXXXXXXXXXXXXXXXXXXXXKLAPGVSQLAYTCVQDHPIWINQQFWETTFYNSVQN
QVRSLYLSAKEDNHSAHLKQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVAMHIETLEAVH
RESRRLPPIQKPKILRPALLPGEEIVCEGLRVLLDPDGREEATGGLLGGPHILPAEGALF
LTTYRILFKGTPHDQLVGEQTVVRSFPIASITKEKKITIPNQLQQNMQEGMQITSASFQL
IQVAFDEEVSPEAVEIFKKQLMKARYPPSIFSTFAFAAGQTTPQVILPKQKEKNTSFRTF
SKTIVKGAKRAGKMTIGRQYLLKRRTGTIMEERGNRPGWNEEDDISXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP
TSSLETSSSIEQEKYLQALLNAISVHQKLSGSNTLTVRPALALSPGVWASLRSSNRFITS
PASFIDVGARLAGKDHPPSFSNNAYLQNQLLKRQAALYIFGEKSQLRGFKLEFALNCEFV
PVEFNDIRQVKASFKKLMRACVPSSIPTDSEVTFLKALGDSEWFPQLHRLLLLAVVVAEV
LESGSSVLVCLEDGWDITTQVASLAQLLSDPFYRTLAGFRMLVEKEWLSFGHKFSQRSNL
TFNCQGSGFAPIFLQFLDCVHQVHNQYPTEFEFNQYYLKFLAFHYVSNRFKTFLLNSDHE
RLEHGTLFEDKGDKHAKKGICIWECIERMHKRSPIFFNYLYAPVETEVLKPSINVSSLKK
WDYYMEETLSTGPSYDWTMLTTKSTPHEDTDQAEGARPQSQRRIVWPCYDDVSKVQPDAV
TSLFNEIERLEHKLNQTPERWQQLWERVSTNLKEDTRQDQPRRHPSSSSGIVTTNLHSYQ
KRSLLHLPDSGLGEEQNASIPPSNGVGRRAATLYSQFTSKIDENXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLRYYDSGEDTSCKGHIDLAEVETIIPATPTMGAPKHASDKAFFDLK
TSKRVYNFCAQDSQSAQQWMDRIQSCISDA
Download sequence
Identical sequences ENSMEUP00000007348 ENSMEUP00000007348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]