SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007556 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007556
Domain Number 1 Region: 568-679
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-24
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 810-867
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000168
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000007556
Domain Number - Region: 119-244
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00144
Family CRAL/TRIO domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007556   Gene: ENSMEUG00000008249   Transcript: ENSMEUT00000008291
Sequence length 1021
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9390:5429:16444:1 gene:ENSMEUG00000008249 transcript:ENSMEUT00000008291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPRKEGSVDPPPPAHATDWRYAVCSYDDALVEEGSVHTLEELGEARGPPGPPLEAALEEK
LQGGPRMYPPAPLDGQRRKGPSSAAMKGGEDPSRAESKGPSSGLSMPVRSTFAQDLSPEL
LDSGLAALPGTRDSEGRVVLLICTQNLAWHGPHCGVQELTGLFLYLHSIPRLEDRARGLT
VLVDARHCLPSPRLFLGLSQMQLELLPSRQALLSFIPNSQLPLALGGCLPYSHHAWLCFQ
KRLEALKQSYLEACVLLREAIENVEAAPKSEDPGEAGQLLQDPRELMQKVLAYPLLAWLQ
REGGAALAELWRQQVVQSLEHRLAIDEAGKLYAEVDGLLHQLVTLCNRRMRELELGKLLE
AWAGALAEIQAWLQNVGWPGLKGPEESSLDVLLQAWDAFSKLDQAAQEHIHRGEEILAGW
EVTELGQLGAPGARLISLQTQLSEFSRALARRRWQLMDAQKLSQMLNQALAQAQAGQKAL
AKLAEEKHASPEAVLHHLEGHRLSHPDLAPSHFQEMEALAVGLGSDLTFQQCHSWAWCQD
TQLVLARKLEAAVTAGAACQGPPVPALHLILGEMVATEREYVRALDYVVESYFPELERAD
VPQGLRGQRARLFGNLEKLRDFHRRFFLRELESCNQHPLRVAYAFLRHREQFGMYALYSK
NKPRSDALLASHGNAFFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTADIGLTENCGESGLCFEIWFRRRKASDTFV
LQALSTENKQAWTADIASLLWRQAARNKELRMAEMVSMGVGNKPFLDITPSEAAINDRAI
NYIMKGRGARTRASIAVSLFDHTNPYPGSPTPLPTGPSSCSLLGPLNLHLCGDPAQLGLC
WPLHLSLPGRGLDPETDTGSQPSLTPESSEASSQCPSASSSGSDSGCAPGLTRASGCEEQ
P
Download sequence
Identical sequences ENSMEUP00000007556 ENSMEUP00000007556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]