SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007638 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007638
Domain Number 1 Region: 1124-1233
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-27
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 1231-1324
Classification Level Classification E-value
Superfamily PH domain-like 0.000000246
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000007638
Domain Number - Region: 1750-1944
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00022
Family WD40-repeat 0.057
Further Details:      
 
Domain Number - Region: 1028-1058
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00314
Family DBL homology domain (DH-domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007638   Gene: ENSMEUG00000008310   Transcript: ENSMEUT00000008376
Sequence length 2027
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2493:2791:67994:1 gene:ENSMEUG00000008310 transcript:ENSMEUT00000008376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGPPPPPLYRSISFKRLERWSGGPGLWEETTSSSPGLRRRSRTATLAASRRVSKLASG
GTGAAATSSPRPLRSLSPSVRQLSQRFDSASRGSRRDGSAGPGGGAVGFSAEEGAARVGA
RGPWPSVTEMRKLFGGQNFRRPSPDGLWGSSSPASATKGLRAQEPLGRQQPPPPPPRTCF
PLSGLRSPLPRAQAEGRRQQQADSSHSWHSYCQPHAGPQASVCSSSSSPATAFYPVSRSL
SRGESSSEEEEQPGSPGSLLQRRGQPSGGSGGEGNREKVSSRLPPAGSAGGWDLDNDGLK
PGRMDSSEDPRSGPGPSEARMYIREPPVFRGSQEGLRQFTRGLPESFGSTFPMVSRVAKV
SFPPYVASLGRHSSTEKLKEEDLWTGRGSWGLYRSPSFGTGDSFLRPQAHSRPKGQRDNL
RGEPSYKVTELEKNRQRKSLSNPDIASETLTLLSFLRSDLSELKVRRSGRRPGDHDGVPQ
SCSDASEDSELTGHQGPLLAPARQALGTRPTLKDLTATLRRAKSFSCSETPSPRRLSRTG
ALKPSSSELLLARRRAEEEEEEDGLPEVVQDQYVQEAQQVFEKISQMGAQQDDGDPPTCT
CPQAPCQRSLEELSGPESSLTDEGIVTEPEPASIAYRGLGIRVEVWGVPLSSSRINPSGS
PPERLGLGPLDAPGTPGALRRRRKGPTVGLGGTDLSNGDAGEAYRSLSDPMPHHHRPTPF
EESSGFSVDSNLLGSLGPKAGLPTTSAMALADCGAAGASDSSIGSDGGKDFQAVIQSVVH
QPGALGRAVDERVHGRAAKKKSLSDPSRRGEQASPGFEGPGGEPILEAALPPASSEPILL
EHQSGEAGKTRAQSERVLPKALPVTAPLDFHLDPKLANVLSPXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXDMRKHVIMTLLDTEQSYVESLRTLMQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSKDILVNIYSAYIDNFLNAKD
AVRIAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPD
RPFLIDAHRNIKQVAEKINKGMKNAEEVERHARVLLEIEAHIEGMEDLQAPLRRFLRQEM
VVEVKAVGGKKDRSLFLFSDLLVCTTLKRKSGSLRRSSMSLYTAASVIDIASKYKLLWKL
PLEDADIIKGASHATNRESVQKAISHLDEDLNTLGQISKLSESLSFPHQSLDDVIKELTT
AAHRDLAEKQALCYTLSFPPNKVELSATRPEGTDTFIFEFPHPDARVGFEQAFDEAKRKL
ASSKNCLDPEFLKAIPIMKTRSGMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXYLDNQVFVSLANGELVVYNREAGHFWDPQNSKSLVLGSPGNPVTKMVSVSGKLWC
GCQNRIFVLNTGSLQQEHTFQVGLDPNRNVACMVNSSLGVWIALQSTAQVRLYHTGTFEQ
LAEVDITPPVHKMLAGSDAIIRQHKAACLRITALLACEDLLWIGTSAGVVLTMPTSPNTI
TTPRAPLSPAGLVQGHTGHVRFLTAIELPDNFDLLCPPPSHDASPEKSALLERRDSSRHR
GSAPALVKPKMLVISGGDGYEDFRLSSSSSETVGRDDSTNHLLLWRV
Download sequence
Identical sequences ENSMEUP00000007638 ENSMEUP00000007638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]