SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008153 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008153
Domain Number 1 Region: 550-702
Classification Level Classification E-value
Superfamily Bet v1-like 0.000000000000989
Family STAR domain 0.042
Further Details:      
 
Domain Number 2 Region: 200-236
Classification Level Classification E-value
Superfamily PH domain-like 0.0000153
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008153   Gene: ENSMEUG00000008914   Transcript: ENSMEUT00000008951
Sequence length 704
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2753:22879:89773:-1 gene:ENSMEUG00000008914 transcript:ENSMEUT00000008951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCPTPLSASHLPGPEREADWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTES
GYGSESSLRRHGSMVSLVSGASGYSATSTSSFKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXVEDDEDDFPTTRTDGDLLHNTNGNKEKLFPHVTPKGINGI
DFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKEIEKKRRIEEAYKNAVTELK
KKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKNRLHWPTSLPPSSDV
YSSVGTHRFAQQPYSRSSSMSSIDLVSASDDVHRLSAQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVYRREVEENGIVLDPLKATHAVKGVTGHEVCSYFWNVDVRNDWEXXXXXX
XXXXXXXXXXXXXXXXXXRVWPASQRDVLYLSAIRKIPTLTESDSETWIVCNFSVDHDSA
PVNNRCVRAKINVALICQTLVSPPEGNQEISRDNILCKITYVAN
Download sequence
Identical sequences ENSMEUP00000008153 ENSMEUP00000008153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]