SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008334 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008334
Domain Number 1 Region: 314-415
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000587
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000008334
Domain Number - Region: 71-104
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00698
Family DBL homology domain (DH-domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008334   Gene: ENSMEUG00000009125   Transcript: ENSMEUT00000009153
Sequence length 508
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_10162:648:8494:1 gene:ENSMEUG00000009125 transcript:ENSMEUT00000009153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPSNKRVRSLARVSSLANLISPVRNGAVRRFGQTIQSFTLRGDNRSPACAQKSFSRATVP
TPSKRRNNVRWSEMLDINMKESLTTKEIKRQEAIYEMLRGEQDLIXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXKLYIFLFQEILVLTRPVIRNERHSYQVYRQPIPVQELVLEDLHDGD
VRMGGSFRGAFSNSDKAKNIFRVRFREPLPGQSHTLQANDVFHKQQWFNCIRTAITPFHQ
ITSPIEFKGLSELNKGCEKNNSDPTAQRKSAALSGLIPLEVDENSPEYTSSVAVNEDSTG
IKAYKIQSGSQKAQEKVQLNDKRKETLV
Download sequence
Identical sequences ENSMEUP00000008334 ENSMEUP00000008334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]