SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008431 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008431
Domain Number 1 Region: 53-165
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-23
Family C-type lectin domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008431   Gene: ENSMEUG00000009232   Transcript: ENSMEUT00000009256
Sequence length 167
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2530:14597:20059:-1 gene:ENSMEUG00000009232 transcript:ENSMEUT00000009256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTREELSGQENSPLHTERGIQNQTTNSNPDGSLRVPVPCAVLPVVIIAILIITIIALSV
GQYNCPGKYVSENTSPLMTSMSLDLSVSSCPDSWIGYRGKCYIFSNTTANWTPQNACSSH
DSTLAQIDSKEDLIFLKRYASNVEHWIGLKNETDQAWRWTNGKEFSG
Download sequence
Identical sequences ENSMEUP00000008431 ENSMEUP00000008431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]