SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008460 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000008460
Domain Number - Region: 145-214
Classification Level Classification E-value
Superfamily PH domain-like 0.00178
Family TFIIH domain 0.032
Further Details:      
 
Domain Number - Region: 21-72
Classification Level Classification E-value
Superfamily PH domain-like 0.0301
Family GRAM domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008460   Gene: ENSMEUG00000009264   Transcript: ENSMEUT00000009291
Sequence length 294
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6834:12217:36517:1 gene:ENSMEUG00000009264 transcript:ENSMEUT00000009291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLDALWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWX
SLVSVGYNCIINITTRAANSKLRGQTEALYILTKCNNTRFEFIFTNVVPGNPRLFTSVIA
VHRAYETSKMYRDFKLRSALIQNKQLRLLPQEQVYDKINGVWNLSSDQGNLGTFFITNVR
IVWHANMNDSFNVSIPYLQIRSIKVRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQES
VKEINSLHRVYSASPIFGVDYEMEEKPQPLEDLTVEQIQDDVEIESEEHTDAFV
Download sequence
Identical sequences ENSMEUP00000008460 ENSMEUP00000008460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]