SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008475 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008475
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-33
Family DBL homology domain (DH-domain) 0.00067
Further Details:      
 
Domain Number 2 Region: 158-240
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000138
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008475   Gene: ENSMEUG00000009285   Transcript: ENSMEUT00000009308
Sequence length 255
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_6570:2903:5045:-1 gene:ENSMEUG00000009285 transcript:ENSMEUT00000009308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFVCILRAKGTLRPAELQAVFGPWEAVHAASQELLPHLEAGRWGAGLAGLCRHLELYTRF
AANQERASATLQKWLKKKRFRRFVRLQEGRPEFGGLRLVDLLPLPLQRLQQYENLVVALA
ENTGPDNSDYQQLTKAAQKLSEVTQKVSAIGREHENGRQLQRIQTLLSGRHAKGLTKGRW
FLRQGWLLVVPPKGEPKSRMFFLFSDALLMTKPRSVLHILYGGTFVCQALYPMAQCQLQR
IFGHSGGSGGGLLSV
Download sequence
Identical sequences ENSMEUP00000008475 ENSMEUP00000008475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]