SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008497 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008497
Domain Number 1 Region: 108-292
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-20
Family DBL homology domain (DH-domain) 0.0012
Further Details:      
 
Domain Number 2 Region: 288-408
Classification Level Classification E-value
Superfamily PH domain-like 0.00006
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008497   Gene: ENSMEUG00000009296   Transcript: ENSMEUT00000009333
Sequence length 493
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8203:15793:30559:1 gene:ENSMEUG00000009296 transcript:ENSMEUT00000009333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSLRRGSSFTFLTPGPHWDFTLKRKRREKEDDVVSLNSLDFELRNKRFSLAPVLSLANKF
SFVRNGAVQFFGQITSFTLCCKRFHAYVQKSVNRENVPFPKKGTSVRWSKMLDINMKKSL
TPQELKHQKVYQDPLKLSIMSEEEFMYIFGDLDAYIPLHEDLLTRLGEATQPGGKVNLIG
HIVENWLPGLNVREYYSNHLAAKVLLNQKEQDARVQDFLQCLESPLSRKLDLWSFLDISN
HVQYAFLLKEIFRHTPKDHNDIKSPEEGLLIIQEGLSNINLKKRESECQYYIDKVKYLEN
KQKDPRIDARKVLLCHGELKNKNGHKLYIFLFDMIILTPLVVHNECHSSVYHQPIPIQKL
ILEDLQDSGVRTGGSFRDDFSNSYKVFHKQQWFNCVQTVIAPFHQTSNSIEFKGLLEFSK
GCEKNNSLVSRIKAQRKSSASVFILLEVVENSPEYSSCVAVNEDHRKMYRIQYDSQKAQE
KVQLEEIRKETLI
Download sequence
Identical sequences ENSMEUP00000008497 ENSMEUP00000008497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]