SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008774 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008774
Domain Number 1 Region: 33-146
Classification Level Classification E-value
Superfamily PH domain-like 2e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008774   Gene: ENSMEUG00000009617   Transcript: ENSMEUT00000009652
Sequence length 405
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_266:5758:8902:1 gene:ENSMEUG00000009617 transcript:ENSMEUT00000009652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKGSMSRGNRGGPPQHQQNVPSGLLQDHENQRLFGLLGRKCLTLATSVAQLYLALPSTGG
RWQKELSGAICFVKDNPRRSYFIRFYGLQEGRLLWEQEIYTQLVYSAPTPFFHTFPGDDC
QAGLNFADEAEAQVFRALVEEKIQKRSQKQNAERRGGTTPLPLQPSGGSPSLGLVAVDIQ
NPDITSSRYRGLPAPTPPPDKKRSGKKKISKADIGAPSGFXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLPP
TSGAGTPPPPPPPPPPPPSAPSLGGLARGRGALLEEIRQGIQLNK
Download sequence
Identical sequences ENSMEUP00000008774 ENSMEUP00000008774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]