SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008785 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008785
Domain Number 1 Region: 94-205
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-29
Family C-type lectin domain 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008785   Gene: ENSMEUG00000009641   Transcript: ENSMEUT00000009665
Sequence length 206
Comment pep:novel scaffold:Meug_1.0:Scaffold54692:5521:9119:1 gene:ENSMEUG00000009641 transcript:ENSMEUT00000009665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSLILSLLLLGTVSSLHLKNEALGLEASEGEKVLSQELEIPEEGDNLTIWDEDEDDDE
GMRLVAEDDDNLCPKEEDVVHVTGTPGCETCRFLIVKRPRRFRRAQRICKRCYRGHLVSI
HSSHTNLRIQRLAWRIKRSQIWIGAKVRRRFCRRRFWWVDGSRWTFSYWAAGQPGNGGGR
CVALCTRGGHWRRAPCKRRLPFACSY
Download sequence
Identical sequences ENSMEUP00000008785 ENSMEUP00000008785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]