SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008896 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008896
Domain Number 1 Region: 190-336
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-27
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-19
Family Pyk2-associated protein beta ARF-GAP domain 0.0047
Further Details:      
 
Domain Number 3 Region: 102-199
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-17
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008896   Gene: ENSMEUG00000009757   Transcript: ENSMEUT00000009786
Sequence length 345
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2143:13494:56606:-1 gene:ENSMEUG00000009757 transcript:ENSMEUT00000009786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDWASYTLGVFICLSCSIHRNIPNVSKVKSVRLDAWDEAQIEFMACNGNHAGRAKYESKM
PSFYYKPTFSDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYREGFLWKRGRDNGQFLSR
KFVLTEREGALKYFNKNDAKEPKAIMKIEHLNATFQPAKIGNPHGLQITYLKDNSTRNIF
VYHEDGKEIVDWFNAIRAARFHYLQVAFPGASDIDLVPKLSRNYLKEGYMEKTGPKQTEG
FKKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKENSYTVLEGLPPSTQGHHWQHGITIVT
PDRKFLFACETEGDQREWIAAFQKVINRPMLPQEYAVEAHFKHKP
Download sequence
Identical sequences ENSMEUP00000008896 ENSMEUP00000008896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]