SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008969 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000008969
Domain Number - Region: 716-774
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0465
Family DBL homology domain (DH-domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008969   Gene: ENSMEUG00000009829   Transcript: ENSMEUT00000009864
Sequence length 887
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4022:21:19055:-1 gene:ENSMEUG00000009829 transcript:ENSMEUT00000009864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEFRIHDVNELLSLLRVHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTPE
DFLKKYDELKSKNARNLDPLVYLLAKLTEDRETLQYLQQNAKDRAELAASAAMSSSTNFS
IPSTTSKISMQELEELRKQLGSVATGPNLQQSQELTRKMLRDKQSKRNSGHHLPVFPTWV
YERPTLIGDFLVGSGLSSDSAVPVGSLPLASQESAVVEDLLYVLVGVDGRYITAQGLISR
QSRTFLVDPNLDMSVKELVTRILPVAASYSAVTRFIEEKSSFEYGQVNHALAAAMRTLVK
EYMILVTQLEHLQRQGLLSLQKLWFYIQPTMRTMEILASLATSVDKGECLGGATLSLLHD
RSFSYTGDSQAQELCLYLTKAASVPYFEILEKWIYRGIINDPYSEFMVEEHELQKEKIQE
DYNDKYWDQRYTVVQPQIPSFLQKMADKILSTGKYLNVVRECGHDVTCPVAKEIVYTLKE
RAYVEQIEKAFNYASKVLLDFLMEEKELVAHLRSIKHYFLMDQGDFFVHFMDLTEDELKK
PVDDIIPTRLEALLELALRMSTANTDPFKDDLKIDLMPHDLITQLLRVLAIETKQEKSLI
NADPTELTLSGLEAFSFDYIVKWPLSLIINRKALTRYQMLFRHMFYCKHVERQLCNVWIS
NKTAKQLSLPCAKWFAGAFTLRQRMLNFVQNIQYYMMFEVMEPTWHILERNLKSASNIDD
VLSHHTSFLDNCLKDCMLTNPELLKIFSKLMSVCVMFTNCMQRFTQSMKLDSELGRPPAE
PGTMLGPPTEAERAEEALKRKLATKYLVEHVDALQLTSGFEGTINKFDKNFSTHLLDLLD
KLSVFSTNDCEHSMVSVISRLDFNGFYTERLERLSAERSQKAVAPVP
Download sequence
Identical sequences ENSMEUP00000008969 ENSMEUP00000008969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]