SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008997 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008997
Domain Number 1 Region: 189-377
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-48
Family DBL homology domain (DH-domain) 0.0000108
Further Details:      
 
Domain Number 2 Region: 384-510
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-31
Family Pleckstrin-homology domain (PH domain) 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008997   Gene: ENSMEUG00000009855   Transcript: ENSMEUT00000009892
Sequence length 613
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4492:484:8406:1 gene:ENSMEUG00000009855 transcript:ENSMEUT00000009892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPDRSTSGRTDRMLGAMGGMLRACAXXXXXXSPSRSLLRLGERETEAKSTKWDKRGEV
ETAASAPTRELESYSIAGSEGSVSASVASVLAPTSVPSSGFSSGPCSPGPPGPISGLRRW
LDHSRHCLSVETETDNDQAGSCQGWIRESTLASGEELPELTLLTTLLEGPGDRTQPTEET
PTQTTESEEEKRKRALDRSMYVLGELVETEKMYVEDLGQIVEGYMATMTAQGIPENLRGR
DRIVFGNIQQIYEWHRDYFLQELQKCLQDPDWLAQLFIKHERRLHMYVIYCQNKPKSEHV
MSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMQYQLLLKDFLKYYSKAKKNTEELEHA
VEVMCFVPKRCNDMMSLGRLRGFEGKLTTQGKLLGQDTFWVTEPEAGGLLPARGRERRVF
LFEQIVIFSEALGGGVRGGTQPGYVYKNSIKVSCLGLEKNTQGDPCRFTLTSRGPEGGVQ
RYILQASDPTISEAWTQHIAQILESQRNFLNALQSPIEYQRRESQTNSLGRIGGSVGGSP
GRSRLGDRAPISTHTPINGSLPSLLLPPVGVAESHLPQNEQLVFLLDLANQAPPAPEDLI
CQARLAKLDEDEL
Download sequence
Identical sequences ENSMEUP00000008997 ENSMEUP00000008997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]