SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009217 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009217
Domain Number 1 Region: 564-755
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-46
Family DBL homology domain (DH-domain) 0.00047
Further Details:      
 
Domain Number 2 Region: 67-148
Classification Level Classification E-value
Superfamily F-box domain 8.37e-19
Family F-box domain 0.00081
Further Details:      
 
Domain Number 3 Region: 793-903
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000322
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009217   Gene: ENSMEUG00000010084   Transcript: ENSMEUT00000010131
Sequence length 904
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9771:8184:86047:1 gene:ENSMEUG00000010084 transcript:ENSMEUT00000010131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IECFQRRFSAWTPIINKSLNKQLFQERVGLITHWFDLWTDKQRKEFLLTILQNCSHSQLK
FVKDWFSEKIPMVKVDFCTVLPRFISLHIFSFLNPMDLCSAAQVNWPWKFLTEQDCLWRP
KCIRFGWFLPYDSPDNEYGAWKRHYIACVATLDWLTPREASAIYGTLNEPKSENEEQGER
KRERQLRKMIWGRLALQKRELFKVRPPWMSGTCCSTVLKSRYQPQLPQVIKDRIGLSTAL
EKQLLLASLEALPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYTI
GVENVLTPEVQDFWEKLGSCVATQEEGGHVDIFVPLAASEAGTKVLSQLSQLTGTMFSSP
TGIATGSYQHXXXXXXXXXXXXXXXXXYFCDHKLQTWHSFTDFLEETLKSARKQLRPHFE
ELQRNISGKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERNMKEDNSQDRKT
GITEDELKLEVLVNLERKLQMDLAEKRTRIAGELLKSERKYVQMLETVRDVYVTPLKAAL
ASNRAILSSTDVQIIFSDILDVLDLNRHFLEELTERLQEWGPAQCLGEIFINFGLQLKTY
TNFFNNYPIVLKTIEKCREMVPSFRAFLKRQDKTIVTRMMSLQELLLYPPRRFEEYINLL
YGLRLHTPSEHVDRGDLTTAIKQMKRYIGYINQXXXXXXXXXXXXXXXXXXXXXXILSEG
NRFLIRVQDVAQLRCCNEEVSFSLRLYEHIHDLSLFLFNDSLLVSHRTVAHIPFQRTTQT
TYQFLELVALHQLLIEDIPDSKYIKNAFVLHGPKCQWICSTVNEDKLVWLSVLQSAIRSS
IEKY
Download sequence
Identical sequences ENSMEUP00000009217 ENSMEUP00000009217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]