SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009271 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009271
Domain Number 1 Region: 64-286
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-55
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 276-333,371-432
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-18
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 3 Region: 557-623
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000163
Family Pleckstrin-homology domain (PH domain) 0.0065
Further Details:      
 
Domain Number 4 Region: 421-493
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000139
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009271   Gene: ENSMEUG00000010155   Transcript: ENSMEUT00000010193
Sequence length 629
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5587:21556:48375:1 gene:ENSMEUG00000010155 transcript:ENSMEUT00000010193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLGAETKVPRSEQEQHGSMLKKPQTPEPWKSTNLEDTLGPGQRAVSTRLLSSLKNKLSDG
SWRKSCEATVNVRMQEPEENKIVRELLETEKAYVSRLHLLDQVLQVFFEELLKEARSSKA
FSEDVVKLIFSNISSIHQFHSQFFLPEIQRRVDKWAAIPRIGDVIQKLAPFLKMYSEYVK
NFERAAELLAIWMEKCPPFQEVITRIQNSEVSGNLTLQHHMLEPVQRIPRYELLLKEYVQ
KLPPDAPDQADAQKALDMIFSAAQHSNAAITEMERLQNLWDVYQRLGLEDDIVDPSNELL
QEGPIQKISFRHSSTMERYLFLFNNMLLYCIPKVIQVGXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXVRELNDVEFPHSFLVSGKQRTLELQAQSQEEMNSW
IQACQRAIDQIGKRHETFKAAIQGPEGDMEEHQLKSEELGIRAPQWVRDKMVTMCMRCKT
PFNALTRRRHHCRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXEQSLMCSFLQLLGDKWGKGSSRGWCVIPRDDPLVLYIYAAPQDMKAH
TSIPLLGYQVTNGPPTDARAFQLQQSGLY
Download sequence
Identical sequences ENSMEUP00000009271 ENSMEUP00000009271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]