SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009459 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009459
Domain Number 1 Region: 177-321
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-18
Family DBL homology domain (DH-domain) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009459   Gene: ENSMEUG00000010371   Transcript: ENSMEUT00000010401
Sequence length 321
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_10060:24137:45584:1 gene:ENSMEUG00000010371 transcript:ENSMEUT00000010401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMIQAITTKQEEMQQKIEQLQQEKRRESRKVKTKKTQKEEHVSPAGAAPTQGSPFRSIN
IPEPVLTSEDFTNILPTQAYEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKR
QTVALELLESERKYVINISLVLKIKATFQGSDGKRSTKERSLFPGSLRYLVQQHLDLLHA
LQERVLKWPRQGVLGDLFLKLTNDENNFLDYYVAYLRDLPECISLVHVVVLKEAEEEIKS
DLYTLFFHIVQRIPEYLIHLQ
Download sequence
Identical sequences ENSMEUP00000009459 ENSMEUP00000009459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]