SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009635 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009635
Domain Number 1 Region: 905-1058
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-33
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 2 Region: 538-614,644-746
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.55e-32
Family DBL homology domain (DH-domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 223-367
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-32
Family Third domain of FERM 0.00063
Further Details:      
 
Domain Number 4 Region: 737-758,790-889
Classification Level Classification E-value
Superfamily PH domain-like 5.14e-22
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 5 Region: 117-225
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000403
Family Second domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009635   Gene: ENSMEUG00000010555   Transcript: ENSMEUT00000010591
Sequence length 1075
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_6046:552:79843:1 gene:ENSMEUG00000010555 transcript:ENSMEUT00000010591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEQKPTPGSRLGAPENAGISTLEHGQKLPTVPPGKLISIKIQMLDDTQEAFEVPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKHVVVKFVVKFF
PPDHAQLQEELTRYLFALQVKQDLAQGRLTCNETSAALLISHIVQXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXGQTPAESDFQLLEVARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANXXXXXXXXXXXXXXX
XXXXXXEICVEHHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQKQVLDYVKEGGHKKVP
FERKHSKIQSIRSLSAQPSEQNSEVPKQPLQSSSFTYGDGADSPGGQSCHQGKELNISVE
ESGQHRSPSLKKSPEDGRRVDGVVMATMEEEEEVVKDRTRPSNPQSQQPSTGSLTGSPHL
SELSINSQGGPAAANMTLSPNLSPDTKQSSPLVSPLLNDQTCTRTDDEEEVRRKRFPTDK
AYFIAKEVSTTERTYLKDLEVITSWFQSTVNKDESMPETLKSLIFSNFEPLHKFHTSFLK
EIEHRLALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGIKNSRR
LESFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQIMERLCKHYPPNHSDFRDCRAALAEI
TEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVIPERXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXEFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTATNQFKVHGQLPLYG
MTIEESEEEWGVPHCLTLCGQHQSIIVAASSRIEMEKWVEDIQMAIDLAEKSSGPTPELV
ASSPPEXXCPDDSTADQESEDDLSASRTSLERQSPHRGNTMVHVCWHRNTSVSMIDFSIA
VENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPLESE
NIHKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATTSASRACVLSHKESHVY
Download sequence
Identical sequences ENSMEUP00000009635 ENSMEUP00000009635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]