SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009749 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009749
Domain Number 1 Region: 209-456
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.31e-41
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000009
Further Details:      
 
Domain Number 2 Region: 522-593
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000965
Family Ricin B-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009749   Gene: ENSMEUG00000010681   Transcript: ENSMEUT00000010716
Sequence length 596
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9009:2387:178473:1 gene:ENSMEUG00000010681 transcript:ENSMEUT00000010716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSADAFRDIHPRAEAANLSQRGPNPVQ
DGVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPSTLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
ITGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKRLKCKNFQWYLDHVYPEMRRYNNTIAYGEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXLTRYTREGFLHLGALGTTTLLPDTRCLVDNSKSRFPQLLD
CDKVKSSLHKRWNFIQNGAIMNKGTGRCLEVESRPSIDLILRSCTGQRWTIKNFIK
Download sequence
Identical sequences ENSMEUP00000009749 ENSMEUP00000009749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]