SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009909 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009909
Domain Number 1 Region: 627-815
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-53
Family DBL homology domain (DH-domain) 0.0000000101
Further Details:      
 
Domain Number 2 Region: 820-950
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-33
Family Pleckstrin-homology domain (PH domain) 0.00000101
Further Details:      
 
Domain Number 3 Region: 316-456
Classification Level Classification E-value
Superfamily Spectrin repeat 4.75e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 4 Region: 1050-1104
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000116
Family SH3-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000009909
Domain Number - Region: 493-579
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.000222
Family C-terminal domain of PLC-beta 0.0071
Further Details:      
 
Domain Number - Region: 195-226
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00262
Family CRAL/TRIO domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009909   Gene: ENSMEUG00000010839   Transcript: ENSMEUT00000010888
Sequence length 1122
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_3770:437:95856:1 gene:ENSMEUG00000010839 transcript:ENSMEUT00000010888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCWRFILCKESGSNHCPSPSSQTNEAKEEEIEHQIDVSDVIRLVQDKQQVTVRQPDEI
MHQDITPLCAADIEDQLKKQFAYLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASFPGNLQLVLVLRPTGFLQRTLSDI
AFKFNRDEFKMKVPIIMLSSVPELQSYIDKTQLTEDLGGTLDYCHSRWLSHRTAIESFAL
MVKQTAQMLQSFGTELAETELPNDVQSTSSILSAHTEKKGQMKEDMMLALKEGHTILESI
REPLAKNPESNLNQDQLDNQTTVQRLLDQLGETEAAFDEFWAKHQQKLEQCLQLRNFEQN
FREVKAILNVVSERLSAFTDVGNSYAHVEHMLKDLASFEEKSKEAVEKARALSLEGNQLI
QSKHYAVDSILPKCNELQHLCDEFTTEMGRRRNLLHQSLELHGLLEKSMKWCDDGIYLLA
SQPVDKCQSQDGAESALQEIEKFLDTGAKNKIQELNKVYKEYESILNPDLKEHVQKVFQK
QESMEEMFQKRQVSLKKLAAKQTRPVQPVAPRPEAFTKSPCPSPXXXXXXXXXXXXXXXX
XXXXXXXXXSEMSDIQQGRSGSTTDDEENLAILRRHVMNELIETERAYVEELLCVLEGYA
AEMDNPLMMHLISPALQNKKDVLFGNMEEIYHFHNRIFLRELENYIDYPELVGRCFLERM
EDFQIYEKYCQNKPRSESLWRQCSDCVFFQECQKKLDHKLSLDSYLLKPVQRITKYQLLL
KEMLKYSKNCEGAEDLQEALTSILGILKAVNDSMHLIAITGYDGDLHELGKLLMQGSFSV
WTDHKKGHSKVKDLARFKPMQRHLFLYAKLLLFCKKREDSVDGHEKSMTAVGITENVKGD
VKKFEIWYNAREEVYIIQAPTPEIKATWVNEIRKVLTSQLQACREASQHRALEQTQSLPL
PTSSNTSPSKNQTKNVKKLEERKTDPASLEGYVSSASVPKNPDKNKGWTKTSSSLDAAED
NDGWSSTEEPLNSSDAEEEGGAGPGKLVPGKYTVVADHDEKGGPEALAVKSGDIVELLHE
GEEGLWFVKNMTTSKEGWVPASNLLALIGNSKSAQSLSSSSK
Download sequence
Identical sequences ENSMEUP00000009909 ENSMEUP00000009909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]