SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010247 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010247
Domain Number 1 Region: 520-690
Classification Level Classification E-value
Superfamily Sec7 domain 1.83e-55
Family Sec7 domain 0.0000402
Further Details:      
 
Domain Number 2 Region: 735-870
Classification Level Classification E-value
Superfamily PH domain-like 8.58e-25
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010247   Gene: ENSMEUG00000011211   Transcript: ENSMEUT00000011262
Sequence length 981
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2299:62862:79184:-1 gene:ENSMEUG00000011211 transcript:ENSMEUT00000011262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGTMRFCSEGDCAISPPRCPRRWLPGGPMPESPPASMYGSMGSLIRRVVGPGGGSREL
GRVTAPCTPLRCTPAPRPPSPAGPPQSSVVIFRFVEKANVRTVNGGLSRSLDLGLVPHPQ
PTLAPSSGSSSGLSRKLRLEASTSDPLPAGGNSVPHCPSPLPGSPAQPSTGGDSLYSSLP
NGLGGPPEDLTTLLQGPSGINCQNQGECCSSPREVSAHAQRIARAKWEFFFGSLDPPSSG
SQPQNQEWEQTSASPEGLGHSSEMTTGRVTKYSETDLDAVPLRCYRETDIDEVLAEREEA
DSAIESQPSSEPLGTARVLQPAPRSVPSLDSASEEEDAEEEVDDEVFEASEGAQPVGVPL
KSPLPFLPGSSPSADGPDSFSCIFEAILESHRAKGTSYTSLASLEALASPGPTQSPFFTF
ELPPNHLAPQLDPAPAPLAPLEPDSGTSSAADGPWTEREEEEEEVRRGVDSTQNRAPPSP
CHSEDSFGLGPLPVGSDLPLSQLVSDSDSELDSTEQLALGSTDTLSNGQKADLEAAQRLA
KRLYNLDGFKKADVARHLGKNNDFSKLVAGEYLKFFVFTGMSLDQALRVFLKELALMGET
QERERVLAHFSQRYHQCNPGALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNL
EGLNQGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRVSGGSGGG
SSPFLDLSPEPGAAIYKHGPLVRKVHADPDCRKTPRGKRGWKAFHGILKGMILYLQKEEY
QPGTALVEEELKNAISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAQSLEQMHSWIT
RINVVAAMFSAPPFPAAISSQKKFSRPLLPSSATRLSQEEQVRTHEAKLRAMVSELREHR
ATQPDRKAKSKEAEEQRQKEAYLEFEKSRYGTYAALLRAKLKAGSEELEAVEAALCQAMP
GGIEDGLPASCSSPTLQPEPS
Download sequence
Identical sequences ENSMEUP00000010247 ENSMEUP00000010247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]